-
Add to Cart The item has been addedHPA024176-100ULAnti-MAD2L2 antibody produced in rabbit (C15-1450-659)
Price: $879.43List Price: $977.14Immunogen MAD2 mitotic arrest deficient-like 2 (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA024612-100ULANTI-MAD2L2 ANTIBODY PRODUCED IN RABBIT (C15-1450-818)
Price: $977.14List Price: $1,085.71Immunogen mitotic arrest deficient 2 like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA077998-100ULANTI-MADCAM1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen mucosal vascular addressin cell adhesion molecule 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078602-100ULAnti-MAEL antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to maelstrom spermatogenic transposon silencer Sequence PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA028289-100ULAnti-MAF antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA024821-100ULAnti-MAF1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen MAF1 homolog (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA055371-100ULAnti-MAFF antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog F Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedABE1928Anti-MafK/Nfe2u Antibody (C15-1316-990)
Price: $828.00List Price: $920.00Transcription factor MafK (UniProt Q61827 also known as Erythroid transcription factor NF-E2 p18 subunit, Nuclear factor erythroid derived 2 ubiquitous, p18 NF-E2) is encoded by the Mafk (also known as Nfe2u, AW061068) gene (Gene ID 17135) in -
Add to Cart The item has been addedHPA003333-100ULAnti-MAGEA10 antibody produced in rabbit (C15-1445-898)
Price: $879.43List Price: $977.14Immunogen melanoma antigen family A, 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA070780-100ULAnti-MAGEA10 antibody produced in rabbit (C15-1465-907)
Price: $928.29List Price: $1,031.43Immunogen melanoma antigen family A10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA052687-100ULAnti-MAGEA11 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen melanoma antigen family A11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA000611-100ULAnti-MAGEB10 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Melanoma-associated antigen B10 recombinant protein epitope signature tag (PrEST) Application Anti-MAGEB10 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each
