-
HPA008444-100UL
Anti-MAGI3 antibody produced in rabbit (C15-1447-144)
Price: $879.43List Price: $977.14Immunogen membrane associated guanylate kinase, WW and PDZ domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA044417-100UL
Anti-MAK16 antibody produced in rabbit (C15-1458-139)
Price: $928.29List Price: $1,031.43Immunogen MAK16 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050574-100UL
Anti-MAK16 antibody produced in rabbit (C15-1460-353)
Price: $928.29List Price: $1,031.43Immunogen MAK16 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA037687-100UL
Anti-MAML1 antibody produced in rabbit (C15-1454-850)
Price: $928.29List Price: $1,031.43Immunogen mastermind-like 1 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA057531-100UL
Anti-MAML1 antibody produced in rabbit (C15-1462-681)
Price: $928.29List Price: $1,031.43Immunogen mastermind-like transcriptional coactivator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA035223-100UL
Anti-MAML2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mastermind-like 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA037717-100UL
Anti-MAML3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mastermind-like 3 ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA048352-100UL
Anti-MAN1C1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mannosidase, alpha, class 1C, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA026896-100UL
Anti-MAN2A1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Alpha-mannosidase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA017226-100UL
Anti-MAN2A2 antibody produced in rabbit (C15-1448-701)
Price: $879.43List Price: $977.14MAN2A2 (Mannosidase, α, class 2A, member 2) is a type II membrane protein localized in the cisternae of the Golgi bodies. It exists in several isoforms: lysosomal α-mannosidase, endoplasmic reticulum α-mannosidase, cytoplasmic -
HPA077930-100UL
Anti-MAN2A2 antibody produced in rabbit (C15-1467-115)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to mannosidase alpha class 2A member 2 Sequence TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA037005-100UL
Anti-MAN2B2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mannosidase, alpha, class 2B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,