-
Add to Cart The item has been addedHPA052484-100ULAnti-MAP1LC3A antibody produced in rabbit (C15-1461-033)
Price: $928.29List Price: $1,031.43Immunogen microtubule-associated protein 1 light chain 3 alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA042824-100ULANTI-MAP1LC3B ANTIBODY PRODUCED IN RABBIT (C15-1457-395)
Price: $977.14List Price: $1,085.71Immunogen microtubule associated protein 1 light chain 3 beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA053767-100ULAnti-MAP1LC3B antibody produced in rabbit (C15-1461-443)
Price: $928.29List Price: $1,031.43Immunogen microtubule-associated protein 1 light chain 3 beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA072670-100ULAnti-MAP1LC3C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen microtubule-associated protein 1 light chain 3 gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA050934-100ULAnti-MAP1S antibody produced in rabbit (C15-1460-462)
Price: $977.14List Price: $1,085.71Immunogen microtubule-associated protein 1S recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA054637-100ULAnti-MAP1S antibody produced in rabbit (C15-1461-743)
Price: $928.29List Price: $1,031.43Immunogen microtubule-associated protein 1S recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAB15452Anti-MAP2 Antibody (C15-1315-773)
Price: $869.14List Price: $965.71Specificity MAP2 [Microtubule associated protein 2] Other species have not yet been tested. It is expected that the antibody will also react with human due to immunogen sequence similarity. -
Add to Cart The item has been addedAB5543Anti-MAP2 Antibody (C15-1316-289)
Price: $852.00List Price: $946.67Specificity Microtubule Associated Protein 2 (MAP2). It is expected that the antibody will react with all mammals. -
Add to Cart The item has been addedHPA008273-100ULAnti-MAP2 antibody produced in rabbit (C15-1447-099)
Price: $879.43List Price: $977.14Immunogen Microtubule-associated protein 2 recombinant protein epitope signature tag (PrEST) Sequence SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK -
Add to Cart The item has been addedHPA012558-100ULANTI-MAP2 ANTIBODY PRODUCED IN RABBIT (C15-1447-797)
Price: $977.14List Price: $1,085.71Immunogen microtubule associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA012828-100ULAnti-MAP2 antibody produced in rabbit (C15-1447-872)
Price: $977.14List Price: $1,085.71MAP2 gene is located at 2q34 on the human chromosome. Microtubule-associated protein 2 (MAP2) is a major cytoskeletal protein in neurons belonging to a family of heat stable microtubule-associated proteins. -
Add to Cart The item has been addedAB2290A4Anti-MAP2, Alexa Fluor 488 Conjugate Antibody (C15-1315-984)
Price: $896.57List Price: $996.19The microtubule-associated protein 2 (MAP-2) is an abundant neuronal cytoskeletal protein that binds to tubulin, stabilizes microtubules (Herzog and Weber, 1978), and is an excellent marker for neurons. MAP-2 is essential for the development and
