-
HPA051250-100UL
Anti-MATN3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen matrilin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA059897-100UL
Anti-MAU2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen MAU2 sister chromatid cohesion factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
AV39844-100UL
Anti-MAX antibody produced in rabbit (C15-1341-186)
Price: $898.29List Price: $998.10MyC associated factor X (MAX), Myc and Mad are basic helix-loop-helix leucine zipper transcription factors that bind to a specific hexanucleotide element of DNA, the E-box (CACGTG). Myc and Mad form heterodimers with Max to become active regulators -
HPA003474-100UL
Anti-MAX antibody produced in rabbit (C15-1445-974)
Price: $879.43List Price: $977.14Immunogen Protein max recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA031700-100UL
Anti-MB21D1 antibody produced in rabbit (C15-1453-228)
Price: $977.14List Price: $1,085.71The gene MB21D1 (Mab-21 domain containing 1) is mapped to human chromosome 6q13. It is ubiquitously expressed. -
HPA031702-100UL
Anti-MB21D1 antibody produced in rabbit (C15-1453-229)
Price: $889.20List Price: $988.00Immunogen Mab-21 domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA044026-100UL
Anti-MB21D2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Mab-21 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
AV40168-100UL
Anti-MBD1 antibody produced in rabbit (C15-1341-200)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human MBD1 Biochem/physiol Actions MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with -
HPA068850-100UL
Anti-MBD1 antibody produced in rabbit (C15-1465-561)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to methyl-CpG binding domain protein 1 Sequence PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA043121-100UL
Anti-MBD3L1 antibody produced in rabbit (C15-1457-534)
Price: $928.29List Price: $1,031.43Immunogen methyl-CpG binding domain protein 3-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA046753-100UL
Anti-MBD3L1 antibody produced in rabbit (C15-1458-977)
Price: $928.29List Price: $1,031.43Immunogen methyl-CpG binding domain protein 3-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA037757-100UL
Anti-MBLAC2 antibody produced in rabbit (C15-1454-884)
Price: $928.29List Price: $1,031.43Immunogen metallo-beta-lactamase domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a