-
HPA006915-100UL
ANTI-MDC1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen MDC1 protein. Application Anti-MDC1 protein antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . -
HPA031235-100UL
Anti-MDGA1 antibody produced in rabbit (C15-1453-043)
Price: $889.20List Price: $988.00Immunogen MAM domain containing glycosylphosphatidylinositol anchor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA050382-100UL
Anti-MDGA1 antibody produced in rabbit (C15-1460-280)
Price: $928.29List Price: $1,031.43Immunogen MAM domain containing glycosylphosphatidylinositol anchor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA057126-100UL
Anti-MDK antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen midkine (neurite growth-promoting factor 2) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA040411-100UL
Anti-MDM1 antibody produced in rabbit (C15-1456-189)
Price: $928.29List Price: $1,031.43Immunogen Mdm1 nuclear protein homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041594-100UL
Anti-MDM1 antibody produced in rabbit (C15-1456-782)
Price: $928.29List Price: $1,031.43Immunogen Mdm1 nuclear protein homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA029666-100UL
Anti-MDN1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen MDN1, midasin homolog (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA003064-100UL
Anti-MDP1 antibody produced in rabbit (C15-1445-771)
Price: $879.43List Price: $977.14Immunogen magnesium-dependent phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070338-100UL
Anti-MDP1 antibody produced in rabbit (C15-1465-828)
Price: $928.29List Price: $1,031.43Immunogen magnesium-dependent phosphatase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA052999-100UL
Anti-MDS2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen myelodysplastic syndrome 2 translocation associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA006493-100UL
Anti-ME1 antibody produced in rabbit
Price: $879.43List Price: $977.14ME1 (malic enzyme 1) exists as a homotetaramer, where its two dimers are linked to each other. It is one of the three isoforms of ME enzyme, which are classified according to their sub-cellular localization and cofactor specificity. -
HPA008247-100UL
Anti-ME2 antibody produced in rabbit (C15-1447-094)
Price: $879.43List Price: $977.14Immunogen NAD-dependent malic enzyme, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Sequence DGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPV