Cell Biology

Immunogen matrix extracellular phosphoglycoprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen MER proto-oncogene, tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to mesoderm development candidate 1 Sequence LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen mesoderm development candidate 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen mesoderm posterior bHLH transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mesoderm-specific transcript homolog protein (MEST) is a protein product of an imprinted MEST/PEG1 gene located on the chromosome that is expressed from the parental allele in majority of cell lines and foetal tissues. The gene is transcribed from

The gene METAP2 (methionine aminopeptidase 2) is mapped to human chromosome 12q22. The protein localizes in the cytoplasm.

Immunogen meteorin, glial cell differentiation regulator recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Anti-METTL1 antibody codes for methyltransferase like 1 that has an S-adenosylmethionine-binding motif. It is inactivated upon phosphorylation by PKB and RSK.

The gene METTL1 (methyltransferase-like protein 1) is mapped to human chromosome 12q13. It is ubiquitously expressed.

Immunogen methyltransferase like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Alpha N-terminal protein methyltransferase 1B or methyltransferase-like protein 11B is also called N-terminal RCC1 methyltransferase 2 (NRMT2). Immunogen methyltransferase like 11B recombinant protein epitope signature tag (PrEST) Application All