Cell Biology

Immunogen Antigen KI-67 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen nucleolar protein interacting with the FHA domain of MKI67 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen McKusick-Kaufman syndrome recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen McKusick-Kaufman syndrome recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Megakaryoblastic Leukemia-1 (MKL1, MAL, MRTF-A, BSAC) is a MRTF family transcription factor with evolutionary conserved domains required for actin-binding, homo- and heterodimerization, high-order chromatin organization and transcriptional

The gene MKL1 (megakaryoblastic leukemia (translocation) 1) is mapped to human chromosome 22q13.2.

MKLN1 (Muskelin 1, intracellular mediator containing kelch motifs) is a primarily cytoplasmic protein consisting of mainly two domains, N- and C-terminal domains. Specifically, it is composed of a discoidin-like domain and a LiSH/CTLH domain.

Immunogen muskelin 1, intracellular mediator containing kelch motifs Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen MAP kinase interacting serine/threonine kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

MKNK2 (MAP kinase interacting serine/threonine kinase 2) is a serine threonine kinase belonging to the human MAP kinase-interacting kinases group. It consists of a zinc-binding domain and an atypical open conformation region.

Immunogen Recombinant protein corresponding to MAP kinase interacting serine/threonine kinase 2 Sequence AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Makorin-2 (MKRN2) is a novel ubiquitin E3 ligase that is also known as HSPC070. It is a member of the MKRN gene family.