Cell Biology

MLF2 (myeloid leukemia factor 2) is a 248 amino acid protein, which shares high similarity with MLF1 protein. This gene is localized to human chromosome 12p13, and has an open reading frame of 744bp.

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to muscular LMNA interacting protein Sequence SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

MLK1 (MAP3K9) is a serine&#8211threonine kinase of the Mixed-Lineage Kinase (MLK) family capable of activating the c-Jun N-terminal Kinase (JNK)/Mitogen-Activated Protein Kinase (MAPK) pathway and regulating the other two prinicpal MAPK cascades,

Immunogen mixed lineage kinase domain like pseudokinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

MLL2, also known as Histone-lysine N-methyltransferase 2D, or Lysine N-methyltransferase 2D or ALL1-related protein, or Myeloid/lymphoid or mixed-lineage leukemia protein 2, and encoded by the gene KMT2D/ALR/MLL2/MLL4, is a histone

Histone-lysine N-methyltransferase 2D (EC 2.1.

Myeloid/lymphoid or mixed-lineage leukemia 4 (MLL4) is a histone-lysine N-methyltransferase widely expressed in the nucleus of multiple cell types. It contains a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET domain.

Immunogen myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) translocated to, 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Protein AF-10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the