-
AV53577-100UL
Anti-AP2B1 (AB2) antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human AP2B1 Biochem/physiol Actions AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. -
HPA056733-100UL
Anti-AP2B1 antibody produced in rabbit (C15-1462-433)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 2, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067983-100UL
Anti-AP2B1 antibody produced in rabbit (C15-1465-416)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to adaptor related protein complex 2 beta 1 subunit Sequence PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA036849-100UL
Anti-AP2M1 antibody produced in rabbit (C15-1454-583)
Price: $928.29List Price: $1,031.43The gene AP2M1 (adaptor related protein complex 2 μ 1 subunit) is mapped to human chromosome 3q27.1. -
HPA069870-100UL
Anti-AP2M1 antibody produced in rabbit (C15-1465-774)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 2, mu 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA038737-100UL
Anti-AP3B1 antibody produced in rabbit (C15-1455-422)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 1 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA045458-100UL
Anti-AP3B1 antibody produced in rabbit (C15-1458-525)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039467-100UL
Anti-AP3B2 antibody produced in rabbit (C15-1455-750)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA039818-100UL
Anti-AP3B2 antibody produced in rabbit (C15-1455-917)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA074408-100UL
Anti-AP3D1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, delta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA049270-100UL
Anti-AP3S2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, sigma 2 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA065739-100UL
Anti-AP5B1 antibody produced in rabbit (C15-1464-953)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 5, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive