-
HPA054133-100UL
Anti-MRPL16 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA007455-100UL
Anti-MRPL2 antibody produced in rabbit (C15-1446-896)
Price: $879.43List Price: $977.14Immunogen 39S ribosomal protein L2, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA064814-100UL
Anti-MRPL2 antibody produced in rabbit (C15-1464-739)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA030295-100UL
Anti-MRPL24 antibody produced in rabbit (C15-1452-640)
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein L24 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA054323-100UL
Anti-MRPL24 antibody produced in rabbit (C15-1461-642)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to mitochondrial ribosomal protein L24 Sequence ERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA021416-100UL
Anti-MRPL27 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene MRPL27 (39S ribosomal protein L27, mitochondrial) is mapped to human chromosome 17q21.3-q22. -
HPA030594-100UL
Anti-MRPL28 antibody produced in rabbit (C15-1452-765)
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein L28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA055589-100UL
Anti-MRPL28 antibody produced in rabbit (C15-1462-059)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L28 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA047255-100UL
Anti-MRPL30 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L30 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA018331-100UL
Anti-MRPL39 antibody produced in rabbit
Price: $879.43List Price: $977.1439S ribosomal protein L39, mitochondrial (MRPL39) was originally named as MRP-L5. Immunogen Mitochondrial 39S ribosomal protein L39 (L39mt) (MRP-L39) (MRP-L5). -
HPA038147-100UL
Anti-MRPL44 antibody produced in rabbit (C15-1455-094)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L44 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA038148-100UL
Anti-MRPL44 antibody produced in rabbit (C15-1455-095)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L44 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization