Cell Biology

Immunogen Recombinant protein corresponding to MYC binding protein 2, E3 ubiquitin protein ligase Sequence CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL Application All Prestige Antibodies Powered by

MyCN is a basic helix-loop-helix protein that has been implicated neuroblastomas. Studies have linked childhood neuroblastomas with MyCN amplifications to caspase 8 supression.

Immunogen v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Specificity The pro-inflammatory cytokine IL-1 induced cellular response requires IL-1 receptor complex including IL-1RI and IL-RAcP. Recently, MyD88 was identified as an adapter molecule in the IL-1 signaling pathway (Muzio et al.

Immunogen myeloid-derived growth factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen myeloid-derived growth factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Myelin basic protein (MBP) is a major component of the myelin sheath whose production is developmentally controlled during myelinogenesis. Myelin expression factor 2 (MyEF2), a single-stranded DNA binding factor, is a repressor of myelin basic

MYEF2 (myelin expression factor 2) is a member of the myocyte enhancer factor-2 (MEF2) family of MADS (MCM1, agamous, deficiens, serum response factor)-box transcription factors. It reflects a strong response to the cell division, differentiation,

Specificity Recognizes Myelin Basic Protein in demyelinated nerve tissues. Immunohistochemistry analysis of lesioned rat spinal cord shows a high level of specificity for this antiserum.

Specificity Recognizes Myelin Basic Protein (MBP). Immunogen Synthetic peptide from human/mouse MBP.

Myelin protein P0 is also called Myelin peripheral protein (MPP) and Myelin protein zero (MPZ). Myelin protein P0 is found only in peripheral nervous system and is involved in the creation of an extracellular membrane face which guides the wrapping

Myelin Regulatory Factor (MRF), also known as Myelin regulatory factor, MYRF, and encoded by the gene MYRF/C11orf9/KIAA0954/MRF, is an interesting protein that gets cleaved into two chains. The N terminal component specifically activates