-
Add to Cart The item has been addedHPA027364-100ULAnti-MYOC antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen myocilin, trabecular meshwork inducible glucocorticoid response recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedAb116817-100μlRabbit anti Human MyoD1 Antibody, Recombinant (EP212), could be used for IHC and so on.Application:IHC: 1/50-1/100:Protein Function:Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates -
Add to Cart The item has been addedAb116817-10μlRabbit anti Human MyoD1 Antibody, Recombinant (EP212), could be used for IHC and so on.Application:IHC: 1/50-1/100:Protein Function:Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates -
Add to Cart The item has been addedAb116817-1mlRabbit anti Human MyoD1 Antibody, Recombinant (EP212), could be used for IHC and so on.Application:IHC: 1/50-1/100:Protein Function:Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates -
Add to Cart The item has been addedAb116817-50μlRabbit anti Human MyoD1 Antibody, Recombinant (EP212), could be used for IHC and so on.Application:IHC: 1/50-1/100:Protein Function:Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates -
Add to Cart The item has been addedHPA014305-100ULAnti-MYOM1 antibody produced in rabbit (C15-1448-103)
Price: $879.43List Price: $977.14The gene MYOM1 (myomesin 1) is mapped to human chromosome 18p11.31-p11. -
Add to Cart The item has been addedHPA049193-100ULAnti-MYOM1 antibody produced in rabbit (C15-1459-857)
Price: $928.29List Price: $1,031.43Immunogen myomesin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA001765-100ULAnti-MYOM2 antibody produced in rabbit (C15-1445-404)
Price: $879.43List Price: $977.14Immunogen Myomesin-2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA005953-100ULAnti-MYOM2 antibody produced in rabbit (C15-1446-526)
Price: $879.43List Price: $977.14Immunogen Myomesin-2 recombinant protein epitope signature tag (PrEST) Sequence ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT Application All Prestige -
Add to Cart The item has been addedHPA028132-100ULAnti-MYOM3 antibody produced in rabbit (C15-1451-722)
Price: $879.43List Price: $977.14Immunogen myomesin family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA028340-100ULANTI-MYOM3 ANTIBODY PRODUCED IN RABBIT (C15-1451-789)
Price: $977.14List Price: $1,085.71Immunogen myomesin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA029752-100ULAnti-MYOM3 antibody produced in rabbit (C15-1452-396)
Price: $879.43List Price: $977.14Immunogen myomesin family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
