-
Add to Cart The item has been addedHPA018256-100ULAnti-NDRG3 antibody produced in rabbit (C15-1448-976)
Price: $879.43List Price: $977.14The gene NDRG3 (N-myc downstream-regulated gene 3 protein) has been mapped to human chromosome 20q11.21-q11. -
Add to Cart The item has been addedHPA060532-100ULAnti-NDST1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA051515-100ULAnti-NDST2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA056189-100ULAnti-NDST3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA029768-100ULAnti-NDUFA1 antibody produced in rabbit (C15-1452-407)
Price: $879.43List Price: $977.14Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA054359-100ULAnti-NDUFA1 antibody produced in rabbit (C15-1461-653)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA059529-100ULAnti-NDUFA10 antibody produced in rabbit (C15-1463-296)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA067045-100ULAnti-NDUFA10 antibody produced in rabbit (C15-1465-206)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NADH:ubiquinone oxidoreductase subunit A10 Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT Application All Prestige -
Add to Cart The item has been addedHPA072209-100ULAnti-NDUFA11 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA039903-100ULAnti-NDUFA12 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA041213-100ULAnti-NDUFA13 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA035933-100ULAnti-NDUFA2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
