Cell Biology

Immunogen NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application Anti-NDUFV2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human

Immunogen NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen N-terminal EF-hand calcium-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen N-terminal EF-hand calcium binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene NECAB2 (N-terminal EF-hand calcium binding protein 2) encodes a member of the NECAB family of proteins containing an N-terminal EF-hand domain involved in binding of Ca 2+ . The EF-hand domain contains a single site that binds to calcium

The gene NECAB2 (N-terminal EF-hand calcium binding protein 2) encodes a member of the NECAB family of proteins containing an N-terminal EF-hand domain involved in binding of Ca 2+ . The EF-hand domain contains a single site that binds to calcium

Immunogen N-terminal EF-hand calcium binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 3 Sequence SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 3 Sequence DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen NECAP endocytosis associated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in