Cell Biology

Nuclear factor erythroid 2 (NFE2) is a transcription factor, involved with the regulation of erythroid and megakaryocytic lineage-specific genes. It is a basic leucine zipper (bZIP) heterodimer with two different sized subunit:

Immunogen nuclear factor, erythroid 2-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Nuclear factor erythroid 2-related factor 3, NFE2L3, is a basic-region leucine zipper (bZIP) transcription factor. It is a glycoprotein expressed in the endoplasmic reticulum and the nuclear membrane.

Immunogen nuclear factor (erythroid-derived 2)-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

NFIA is a transcription factor that regulates gliogenesis during spinal cord development. Haploinsufficeincy of NFIA has been linked to urinary tract defects and CNS malformation syndrome.

Immunogen Nuclear factor 1 A-type recombinant protein epitope signature tag (PrEST) Sequence LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ Application All Prestige Antibodies Powered by Atlas

Nuclear factor I A (NFIA) gene is located on the human chromosome 1p31.3.

Immunogen nuclear factor I/C (CCAAT-binding transcription factor) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Nuclear factor, interleukin 3 regulated (NFIL3, E4BP4) is a transcription factor involved in development of haematopoietic lineages. NFIL3/E4BP4 is required for development of NK cells and CD8&#945(+) conventional dendritic cells, and myeloid

Immunogen Synthetic peptide directed towards the middle region of human NFIX Biochem/physiol Actions Nuclear factor I (NFI) proteins constitute a family of sequence-specific transcription factors whose functional diversity is generated through

Immunogen nuclear factor I/X (CCAAT-binding transcription factor) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human