Cell Biology

Immunogen nitrogen permease regulator-like 2 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen UPF0171 protein C16orf35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

NPSR1 (neuropeptide S receptor 1) gene encodes a seven transmembrane G protein-coupled receptor that is a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. It is also called as GPR154 or G-protein coupled receptor for

Immunogen Synthetic peptide directed towards the middle region of human NPTN Application Anti-NPTN antibody produced in rabbit is suitable for western blotting at a concentration of 5&#956g/mL. It is also useful for immunohistochemistry at a

Immunogen neuroplastin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen neuroplastin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen neuronal pentraxin II Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to neuronal pentraxin 2 Sequence ELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

The gene NPVF (neuropeptide VF precursor) is mapped to human chromosome 7p15. It is an orthologue of avian gonadotropin-inhibitory hormone.

Immunogen Recombinant protein corresponding to nuclear receptor subfamily 0 group B member 1 Sequence GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Recombinant protein corresponding to nuclear receptor subfamily 0 group B member 1 Sequence LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT Application All Prestige Antibodies Powered by Atlas Antibodies are

Testicular receptor 2 /nuclear receptor subfamily 2, group C, member 1 (NR2C1, TR2) is a nuclear receptor transcription factor. TR2 is a testicular orphan nuclear receptors that acts to regulate other nuclear receptors.