Cell Biology

Immunogen nuclear receptor subfamily 2, group C, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 2, group C, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor subfamily 2, group C, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

NR2C2 (nuclear receptor subfamily 2, group C, member 2) is a protein encoded by the NR2C2 gene in humans and is mapped to chromosome to 3p25. It is a novel member of the nuclear hormone receptor family.

COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 (COUP-TFII, NR2F2) is a nuclear receptor that regulates amygdale patterning via expression of neurophilin.COUP-TFII is a component of the glucagon-like peptide 1 (GLP-1)

NR2F2 codes for a steroid hormone receptor that is involved in the differentiation of human stem cells and trophoblasts. Genetic variations in NR2F2 are associated with congenital cardiac disorders.

Immunogen Synthetic peptide directed towards the N terminal region of human NR2F2 Application Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions NR2F2 is an orphan

NR2F6 is a nuclear receptor that functions as PKC substrate. This receptor is known to regulate the responses of CD4+ T cell activation.

Immunogen Synthetic peptide directed towards the N terminal region of human NR2F6 Sequence Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the middle region of human NR2F6 Biochem/physiol Actions NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily Sequence Synthetic peptide located within the following region:

Immunogen Glucocorticoid receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Synthetic peptide directed towards the N terminal region of human NR4A2 Biochem/physiol Actions NR4A2 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. The protein may act as a transcription factor.