Cell Biology

Immunogen nurim (nuclear envelope membrane protein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene NRP2 (neuropilin 2) is mapped to human chromosome 2q33. The gene encodes a single-spanning transmembrane glycoprotein.

Immunogen neuropilin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

NRXN3 (neurexin 3) is a neuronal cell surface protein, also expressed in the lung, pancreas, heart, placenta, liver and kidney. In humans, three types of neurexin genes are present i.

Immunogen nuclear receptor binding SET domain protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen nuclear receptor binding SET domain protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to nuclear receptor binding SET domain protein 1 Sequence DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT Application All Prestige Antibodies Powered by Atlas

WHSC1 is an oncogene that regulates cell adhesion, cell cycle advancement and malignant transformation in multiple myeloma. This gene also modulates cellular response to DNA damage and inhibits the synthesis of IL-5 mRNA.

Immunogen Synthetic peptide directed towards the C terminal region of human NSF Biochem/physiol Actions The functions of NSF remain unknown. Sequence Synthetic peptide located within the following region:

The NSF (N-ethylmaleimide-sensitive factor) gene is mapped to human chromosome 17q21. It is a member of the AAA family and encodes a protein containing three domains, namely a SNARE-binding N-terminal domain and two ATPase domains (D1 and D2)

Immunogen N-ethylmaleimide-sensitive factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen NSFL1 (p97) cofactor (p47) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are