Cell Biology

Immunogen outer dense fiber of sperm tails 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The cilium is a cell surface projection found in many vertebrate cells and it is required to transduce signals important for development and tissue homeostasis. OFD1 is important in cilium development, and thus it is important in cellular

The protein named N-glycosylase/DNA lyase or alternatively, 8-oxoguanine (8-OxoG) DNA glycosylase or AP lyase, and encoded by the gene named OGG1/MMH/MUTM/OGH1, is a DNA repair enzyme that incises DNA at 8-oxoG residues and excises

Immunogen Obg-like ATPase 1 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper)

Immunogen Obg-like ATPase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen oleoyl-ACP hydrolase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen oleoyl-ACP hydrolase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to olfactomedin like 3 Sequence LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE Application All Prestige Antibodies Powered by Atlas Antibodies are

Oligodendrocyte transcription factor 2 (UniProt: Q13516, also known as Oligo2, Class B basic helix-loop-helix protein 1, bHLHb1, Class E basic helix-loop-helix protein 19, bHLHe19, Protein kinase C-binding protein 2, Protein kinase C-binding

Oligodendrocyte transcription factor 2 (UniProt Q9EQW6 also known as bHLHe19, Olg-2, Oligo2, RACK17, RK17) is encoded by the Olig2 (also known as Bhlhb1) gene (Gene ID 50913) in murine species. Olig2 is a basic helix-loop-helix (bHLH)

Oligodendrocyte transcription factor 2 (UniProt Q9EQW6 also known as bHLHe19, Olig-2, Oligo2, RACK17, RK17) is encoded by the Olig2 (also known as Bhlhb1) gene (Gene ID 50913) in murine species. Olig2 is a basic helix-loop-helix (bHLH)

Oligodendrocyte lineage transcription factor 2 (OLIG2), a basic helix-loop-helix transcription factor, is an essential regulator of ventral neuroectodermal progenitor cell fate and is required for oligodendrocyte and motor neuron development. OLIG2