Cell Biology

Immunogen Recombinant protein corresponding to poly(A) binding protein interacting protein 1 Sequence GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK Application All Prestige Antibodies Powered by Atlas

Immunogen poly(A) binding protein interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen poly(A) binding protein interacting protein 2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen poly(A) binding protein interacting protein 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen partner and localizer of BRCA2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Paladin recombinant protein epitope signature tag (PrEST) Application Anti-KIAA1274 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Phosphatase domain containing, paladin 1 (PALD1) is a putative cytoplasmic microfilament-associated phosphoprotein consisting of four predicted protein phosphatase (PTP) domains. It is expressed in the vasculature, hematopoietic cells and other

Immunogen paralemmin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Cadherins are glycoprotein receptors that regulate Ca 2+ -dependant adhesion in cells. Cadherins are associated with adherens junctions and are mainly involved in morphogenesis of cells and tissues.

Neurexin-1 (UniProt Q9CS84 also known as Neurexin I-alpha, Neurexin-1-alpha) is encoded by the Nrxn1 (also known as Kiaa0578) gene (Gene ID 18189) in murine species. Neurexin (NRXN) is a presynaptic single pass transmembrane protein that assists

Immunogen PAN3 poly(A) specific ribonuclease subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Pantothenate kinase 2 (PANK2) is localized to the mitochondria. The gene encoding the enzyme is present on chromosome 20.