-
Add to Cart The item has been addedHPA062358-100ULAnti-PANK3 antibody produced in rabbit (C15-1464-057)
Price: $928.29List Price: $1,031.43Immunogen pantothenate kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA078669-100ULANTI-PANK3 ANTIBODY PRODUCED IN RABBIT (C15-1467-184)
Price: $977.14List Price: $1,085.71Immunogen pantothenate kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA011723-100ULAnti-PANK4 antibody produced in rabbit (C15-1447-626)
Price: $879.43List Price: $977.14Immunogen pantothenate kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA012036-100ULAnti-PANK4 antibody produced in rabbit (C15-1447-714)
Price: $879.43List Price: $977.14Immunogen Pantothenate kinase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA027961-100ULAnti-PANK4 antibody produced in rabbit (C15-1451-668)
Price: $879.43List Price: $977.14Immunogen pantothenate kinase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA016930-100ULAnti-PANX1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Pannexin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA071224-100ULAnti-PAPSS2 antibody produced in rabbit (C15-1466-002)
Price: $928.29List Price: $1,031.43Immunogen 3′-phosphoadenosine 5′-phosphosulfate synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA075267-100ULANTI-PAPSS2 ANTIBODY PRODUCED IN RABBIT (C15-1466-705)
Price: $977.14List Price: $1,085.71Immunogen 3′-phosphoadenosine 5′-phosphosulfate synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA073505-100ULAnti-PAQR6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen progestin and adipoQ receptor family member VI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedABC502Anti-PAR-4 Antibody (C15-1316-736)
Price: $785.14List Price: $872.38PAR-4 is a pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells and sensitizing the cells to diverse apoptotic stimuli causing tumor regression. PAR-4 also seems to be a transcriptional repressor and is involved in -
Add to Cart The item has been addedHPA036012-100ULAnti-PARK2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to parkin RBR E3 ubiquitin protein ligase Sequence LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedAB3565Anti-PARP (214/215) cleavage site Antibody (C15-1316-101)
Price: $1,023.43List Price: $1,137.14Poly (ADP-Ribose) Polymerase (PARP) is a 116 kDa nuclear protein which is strongly activated by binding to DNA strand breaks. PARP plays a role in DNA repair as well as in other cellular processes, including DNA replication, cell proliferation and
