Cell Biology

Immunogen pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen poly(rC) binding protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

PCBP4 (also known as MCG10, Poly (rC) binding protein 4 and alpha-CP4) is a member of the KH-domain RNA-binding protein family. Proteins of this family also referred to as alpha-CPs, bind to RNA with specificity for C-rich pyrimidine regions.

Immunogen propionyl CoA carboxylase, alpha polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen propionyl CoA carboxylase, alpha polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen propionyl CoA carboxylase, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen propionyl CoA carboxylase, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Protocadherin 18 (PCDH18) is part of the cadherin superfamily. It is located at the synapses in the central nervous system and contains six ectodomain repeats with cadherin-like features.

Immunogen Recombinant protein corresponding to protocadherin 20 Sequence GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen protocadherin alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen protocadherin alpha 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to protocadherin alpha 6 Sequence PSLSPCPIMMGKAENQDLNEDHDAKV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a