-
HPA002076-100UL
Anti-PCNX4 antibody produced in rabbit (C15-1445-519)
Price: $879.43List Price: $977.14Immunogen pecanex homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA003390-100UL
Anti-PCNX4 antibody produced in rabbit (C15-1445-933)
Price: $879.43List Price: $977.14Immunogen Pecanex homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Sequence NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA048564-100UL
Anti-PCSK1 antibody produced in rabbit (C15-1459-631)
Price: $928.29List Price: $1,031.43Immunogen proprotein convertase subtilisin/kexin type 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA079656-100UL
ANTI-PCSK1 ANTIBODY PRODUCED IN RABBIT (C15-1467-226)
Price: $977.14List Price: $1,085.71Immunogen proprotein convertase subtilisin/kexin type 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA003925-100UL
Anti-PCSK1N antibody produced in rabbit (C15-1446-108)
Price: $879.43List Price: $977.14Immunogen ProSAAS precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA064734-100UL
Anti-PCSK1N antibody produced in rabbit (C15-1464-712)
Price: $928.29List Price: $1,031.43Immunogen proprotein convertase subtilisin/kexin type 1 inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA049627-100UL
Anti-PCSK2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen proprotein convertase subtilisin/kexin type 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA005572-100UL
Anti-PCSK4 antibody produced in rabbit
Price: $879.43List Price: $977.14Proprotein convertase subtilisin/kexin type 4 (PCSK4) is a nuclear DNA binding protein that stimulates activator-dependent transcription. Immunogen Proprotein convertase subtilisin/kexin type 4 precursor recombinant protein epitope signature tag -
HPA031072-100UL
Anti-PCSK5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen proprotein convertase subtilisin/kexin type 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA004774-100UL
Anti-PCSK6 antibody produced in rabbit
Price: $879.43List Price: $977.14PCSK6 (proprotein convertase subtilisin/kexin type 6) is a proprotein convertase (PC) belonging to the PC family. It is expressed in granulosa cells of pre-ovulatory follicles and smooth muscle α-actin positive (αSMA+) cells of the -
ABS1006
Anti-PCSK9 Antibody (C15-1317-672)
Price: $737.14List Price: $819.05PCSK9 protein is an important protein in the regulation of plasma cholesterol homeostasis. PCSK9 binds various lipid receptor protein members including low density lipoprotein receptors (LDLR), very low density lipoprotein receptor (VLDLR), -
HPA035193-100UL
Anti-PCYOX1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen prenylcysteine oxidase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported