Cell Biology

PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia.

PEBP1 (phosphatidylethanolamine binding protein 1), also called Raf kinase inhibitory protein (RKIP), is a member of the PEBP class of proteins. This class was initially identified as the class of proteins specifically interacting with

Immunogen Recombinant protein corresponding to phosphatidylethanolamine binding protein 1 Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

CD31, also known as platelet endothelial cell adhesion molecule 1 (PECAM1) is a type I integral membrane glycoprotein, and a member of the immunoglobulin superfamily of cell surface receptors. PECAM-1 is constitutively expressed on the surface of

Platelet endothelial cell adhesion molecule (UniProt Q08481 also known as CD31, PECAM-1) is encoded by the Pecam1 (also known as Pecam, Pecam-1) gene (Gene ID 18613) in murine species. PECAM-1 (CD31) is a 130-kD cell adhesion molecule that is

PECAM-1 is a type I integral membrane glycoprotein, and a member of the immunoglobulin superfamily of cell surface receptors. PECAM-1 is constitutively expressed on the surface of endothelial cells where it is concentrated at cell junctions.

Specificity Reacts with a 130-140 kDa transmembranous glycoprotein that is expressed widely amongst cells of the vascular compartment. CD31 is expressed on platelets, cultured endothelial cells, monocytes, normal tissue macrophages in tonsil, lung

The previously assigned protein identifier Q9BW86 has been merged into Q9UBM1. Full details can be found on the UniProt database.

Immunogen phosphatidylethanolamine N-methyltransferase recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Immunogen phosphatidylethanolamine N-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Proenkephalin-A precursor (PENK) is the prohormone precursor. The gene encoding it is localized on human chromosome 8q23-q24.

Perilipin-3, also known as Cargo selection protein TIP47, or Placental protein 17, PP17, 47 kDa mannose 6-phosphate receptor-binding protein, 47 kDa MPR-binding protein, also known as Mannose-6-phosphate receptor-binding protein 1, and encoded by