-
HPA062031-100UL
Anti-PHC3 antibody produced in rabbit (C15-1463-973)
Price: $928.29List Price: $1,031.43Immunogen polyhomeotic homolog 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
AV39588-100UL
Anti-PHF1 (AB1) antibody produced in rabbit
Price: $898.29List Price: $998.10PHF1 is a PHD finger protein that regulates p53-dependent cell growth arrest and apoptosis. The Tudor domain of PHF1 is known to interact with histone H3K36me3. -
HPA031038-100UL
Anti-PHF1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen PHD finger protein 1 Fragment recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA055649-100UL
Anti-PHF10 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen PHD finger protein 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA016566-100UL
Anti-PHF11 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen PHD finger protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA021410-100UL
Anti-PHF12 antibody produced in rabbit (C15-1449-856)
Price: $879.43List Price: $977.14The gene PHF12 (PHD finger protein 12) is mapped to human chromosome 17q11.2. -
HPA021452-100UL
Anti-PHF12 antibody produced in rabbit (C15-1449-870)
Price: $879.43List Price: $977.14Immunogen PHD finger protein 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA026830-100UL
Anti-PHF13 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene PHD finger protein 13 (PHF13), also known as survival time associated PHD finger protein in Ovarian Cancer 1 (SPOC1), is mapped to human chromosome 1p36.3, a region associated with chromosomal instability and tumor development. -
HPA000538-100UL
Anti-PHF14 antibody produced in rabbit (C15-1444-973)
Price: $879.43List Price: $977.14Immunogen PHD finger protein 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA017376-100UL
Anti-PHF14 antibody produced in rabbit (C15-1448-759)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to PHD finger protein 14 Sequence TRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRSRRQIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEEEKHEERVPRERRQRQSVLQKKPKAEDLR Application All Prestige Antibodies Powered by Atlas -
AV34760-100UL
Anti-PHF17 (AB2) antibody produced in rabbit
Price: $898.29List Price: $998.10PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly -
HPA010831-100UL
Anti-PHF2 antibody produced in rabbit
Price: $879.43List Price: $977.14PHF2 (PHD finger protein 2) is a member of α-ketoglutarate-Fe 2+ -dependent dioxygenases. This family of proteins contains three members namely, PHF2, PHF8 and KIAA1718.