-
HPA021677-100UL
Anti-PLCD1 antibody produced in rabbit (C15-1449-974)
Price: $879.43List Price: $977.14Phospholipase C-┉ (PLCD1) is located in chromosome 3p21.3-p22 in humans. -
HPA053665-100UL
Anti-PLCD3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to phospholipase C delta 3 Sequence EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK Application All Prestige Antibodies Powered by Atlas -
HPA038139-100UL
Anti-PLCD4 antibody produced in rabbit (C15-1455-087)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038140-100UL
Anti-PLCD4 antibody produced in rabbit (C15-1455-088)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, delta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036681-100UL
Anti-PLCG1 antibody produced in rabbit (C15-1454-481)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, gamma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036682-100UL
Anti-PLCG1 antibody produced in rabbit (C15-1454-482)
Price: $928.29List Price: $1,031.43Immunogen phospholipase C, gamma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA020099-100UL
Anti-PLCG2 antibody produced in rabbit (C15-1449-524)
Price: $879.43List Price: $977.14Phospholipase C-γ-2 (PLCG2) is a multidomain protein which is expressed in mast cells and B cells. The gene encoding this protein is localized on human chromosome 16. -
HPA020100-100UL
Anti-PLCG2 antibody produced in rabbit (C15-1449-525)
Price: $879.43List Price: $977.14Phospholipase C-─ (PLCG2) is a multidomain protein which is expressed in mast cells and B cells. The gene encoding this complex protein is localized on human chromosome 16. -
HPA072705-100UL
Anti-PLCH2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to phospholipase C eta 2 Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA031849-100UL
Anti-PLCL1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen phospholipase C-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA061728-100UL
ANTI-PLCL2 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen phospholipase C like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA007721-100UL
Anti-PLCXD1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas