-
HPA055947-100UL
Anti-PLCXD2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA046849-100UL
Anti-PLCXD3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen phosphatidylinositol-specific phospholipase C, X domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA013397-100UL
Anti-PLD2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Phospholipase D2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
AV44768-100UL
Sigma-Aldrich
Anti-PLD3 antibody produced in rabbit (C15-1341-517)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human PLD3 Application Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml. -
HPA012800-100UL
Anti-PLD3 antibody produced in rabbit (C15-1447-862)
Price: $977.14List Price: $1,085.71Phospholipase D3 (PLD3) is a ubiquitously expressed type 2 transmembrane protein. It is present in the endoplasmic reticulum. -
HPA049345-100UL
Anti-PLD6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen phospholipase D family, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA034496-100UL
Anti-PLEKHA3 antibody produced in rabbit (C15-1453-420)
Price: $889.20List Price: $988.00Immunogen pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA034497-100UL
Anti-PLEKHA3 antibody produced in rabbit (C15-1453-421)
Price: $889.20List Price: $988.00Immunogen pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA035923-100UL
Anti-PLEKHA5 antibody produced in rabbit (C15-1454-090)
Price: $928.29List Price: $1,031.43The gene PLEKHA5 (pleckstrin homology domain containing A5) is mapped to human chromosome 12p12. It is from the PLEKHA family. -
HPA035924-100UL
Anti-PLEKHA5 antibody produced in rabbit (C15-1454-091)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family A member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA041455-100UL
Anti-PLEKHA5 antibody produced in rabbit (C15-1456-708)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family A member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA075014-100UL
Anti-PLEKHB2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pleckstrin homology domain containing B2 Sequence YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and