-
HPA025925-100UL
Anti-PLEKHF1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Pleckstrin homology domain-containing family F member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA024829-100UL
Anti-PLEKHF2 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene PLEKHF2 (pleckstrin homology and FYVE domain containing 2) is mapped to human chromosome 8q22. The encoded protein belongs to the Phafin protein family and contains pleckstrin homology (PH) domain and a FYVE (Fab 1, YOTB, Vac 1, and EEA1) -
HPA017973-100UL
Anti-PLEKHG2 antibody produced in rabbit (C15-1448-872)
Price: $879.43List Price: $977.14Pleckstrin homology domain containing family G member 2 (PLEKHG2) is a guanine nucleotide exchange factor for GTPases like Rac and Cdc42. It belongs to the Dbl family. -
HPA048054-100UL
Anti-PLEKHG2 antibody produced in rabbit (C15-1459-417)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA063455-100UL
Anti-PLEKHG3 antibody produced in rabbit (C15-1464-365)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA065323-100UL
Anti-PLEKHG3 antibody produced in rabbit (C15-1464-862)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA073702-100UL
Anti-PLEKHG3 antibody produced in rabbit (C15-1466-428)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pleckstrin homology and RhoGEF domain containing G3 Sequence PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR Application All Prestige Antibodies Powered by Atlas -
HPA074734-100UL
Anti-PLEKHG3 antibody produced in rabbit (C15-1466-604)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pleckstrin homology and RhoGEF domain containing G3 Sequence SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA055696-100UL
Anti-PLEKHG4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036274-100UL
Anti-PLEKHG4B antibody produced in rabbit (C15-1454-260)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 4B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA058157-100UL
Anti-PLEKHG4B antibody produced in rabbit (C15-1462-849)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041459-100UL
Anti-PLEKHG6 antibody produced in rabbit (C15-1456-710)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human