-
HPA061521-100UL
Sigma-Aldrich
Anti-POC5 antibody produced in rabbit (C15-1463-835)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to POC5 centriolar protein. Sequence YVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVH Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA002110-100UL
Sigma-Aldrich
Anti-PODXL antibody produced in rabbit (C15-1445-528)
Price: $879.43List Price: $977.14An anti-adhesive transmembrane protein, PODXL (podocalyxin like), belongs to the sialomucin protein family. It is associated with cancer development and aggressiveness. -
HPA045507-100UL
Sigma-Aldrich
Anti-PODXL antibody produced in rabbit (C15-1458-550)
Price: $928.29List Price: $1,031.43Immunogen podocalyxin-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA042265-100ULImmunogen podocalyxin-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
-
HPA054979-100UL
Sigma-Aldrich
Anti-POLE4 antibody produced in rabbit (C15-1461-853)
Price: $928.29List Price: $1,031.43Immunogen polymerase (DNA-directed), epsilon 4, accessory subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA071815-100UL
Sigma-Aldrich
Anti-POLE4 antibody produced in rabbit (C15-1466-108)
Price: $928.29List Price: $1,031.43Immunogen polymerase (DNA-directed), epsilon 4, accessory subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA031010-100ULImmunogen polymerase (RNA) I polypeptide C, 30kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA022527-100UL
Sigma-Aldrich
Anti-POLR1E antibody produced in rabbit (C15-1450-125)
Price: $879.43List Price: $977.14Immunogen DNA-directed RNA polymerase I subunit RPA49 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA052400-100UL
Sigma-Aldrich
Anti-POLR1E antibody produced in rabbit (C15-1460-998)
Price: $928.29List Price: $1,031.43Immunogen polymerase (RNA) I polypeptide E, 53kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA037506-100ULImmunogen polymerase (RNA) II (DNA directed) polypeptide B, 140kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
-
HPA040919-100UL
Sigma-Aldrich
Anti-POLR2C antibody produced in rabbit (C15-1456-426)
Price: $928.29List Price: $1,031.43Immunogen polymerase (RNA) II (DNA directed) polypeptide C, 33kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA041826-100UL
Sigma-Aldrich
Anti-POLR2C antibody produced in rabbit (C15-1456-908)
Price: $928.29List Price: $1,031.43Immunogen polymerase (RNA) II (DNA directed) polypeptide C, 33kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project