-
Add to Cart The item has been addedABE1069Anti-Polyhomeotic-like protein 2 Antibody (PHC2) (C15-1316-855)
Price: $804.00List Price: $893.33Polyhomeotic-like protein 2 (PHC2), also known as Polyhomeotic-like protein 2 hPH2, Early development regulatory protein 2, is encoded by the gene name PHC2, EDR2, and PH2. PHC2 is a component of a Polycomb group (PcG) multiprotein PRC1-like -
Add to Cart The item has been addedHPA043809-100ULSigma-Aldrich
Anti-POM121 antibody produced in rabbit (C15-1457-882)
Price: $928.29List Price: $1,031.43Immunogen POM121 transmembrane nucleoporin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA049817-100ULSigma-Aldrich
Anti-POM121 antibody produced in rabbit (C15-1460-077)
Price: $928.29List Price: $1,031.43Immunogen POM121 transmembrane nucleoporin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA027836-100ULImmunogen POM121 membrane glycoprotein-like 12 (rat) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA046150-100ULImmunogen POM121 membrane glycoprotein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA046135-100ULSigma-Aldrich
Anti-POMC antibody produced in rabbit (C15-1458-742)
Price: $928.29List Price: $1,031.43Immunogen proopiomelanocortin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA063644-100ULSigma-Aldrich
Anti-POMC antibody produced in rabbit (C15-1464-430)
Price: $928.29List Price: $1,031.43Immunogen proopiomelanocortin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA003663-100ULImmunogen Protein O-mannosyl-transferase 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 -
Add to Cart The item has been addedHPA029193-100ULImmunogen paraoxonase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA066194-100ULImmunogen Recombinant protein corresponding to POP1 homolog, ribonuclease P/MRP subunit Sequence IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA047598-100ULImmunogen processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA024255-100ULImmunogen Popeye domain-containing protein 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
