Cell Biology

Phosphoserine aminotransferase (EC 2.6.

Immunogen prostate stem cell antigen Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Specificity PSD-95 (Post synaptic density 95). By Western blot the antibody recognizes a band at ~95 kDa in rat brain microsomal preparation.

PSIP1 (PC4 and SFRS1 interacting protein 1) is a 75kDa chromatin-associated, cellular protein expressed in the human brain. Immunogen PC4 and SFRS1-interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige

PSKH2 (protein serine kinase H2) belongs to the second category of catalytically inactive kinases, which shows high homology to canonical eukaryotic protein kinases (ePK) domain profile. Immunogen Serine/threonine-protein kinase H2 recombinant

Immunogen protein serine kinase H2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Proteasome subunit a type-2 (PSMA2) is part of the three-subunit proteasome which is involved in degradation of proteins functioning in metabolic regulation and the cell cycle. The gene encoding this protein is present on chromosome 6q27.

Proteasome subunit beta type-1 (PSMB1) is part of the 20S proteasome subunit complex. PSMB1 is mapped to human chromosome 6q27.

Immunogen proteasome (prosome, macropain) subunit, beta type, 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen proteasome (prosome, macropain) subunit, beta type, 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen proteasome (prosome, macropain) subunit, beta type, 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Recombinant protein corresponding to proteasome subunit beta 11 Sequence AADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALAR Application All