Cell Biology

Immunogen Recombinant protein corresponding to protein tyrosine phosphatase, non-receptor type 18 Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen protein tyrosine phosphatase, non-receptor type 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen protein tyrosine phosphatase, non-receptor type 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen protein tyrosine phosphatase, non-receptor type 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to protein tyrosine phosphatase, non-receptor type 21 Sequence KVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGIFVKHKNGRHPVVFRWHDIANMSHNKS Application All Prestige Antibodies Powered by Atlas

PTPN22 (Protein tyrosine phosphatase, non-receptor type 22) is a non-receptor protein-tyrosine phosphatase. It is highly expressed in the T cells.

Immunogen protein tyrosine phosphatase, non-receptor type 22 (lymphoid) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

PTPN6 (protein tyrosine phosphatase, non-receptor type 6) is a 68kDa cytoplasmic protein that is predominantly expressed in hematopoietic cell development, proliferation and receptor-mediated mitogenic signaling pathways. The gene contains 17 exons

PTPRK (receptor-type protein tyrosine phosphatase kappa) codes for RPTP&#954. It is a member of the transmembrane PTP subfamily.

Immunogen protein tyrosine phosphatase, receptor type, K recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen protein tyrosine phosphatase, receptor type, M Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen protein tyrosine phosphatase, receptor type, O recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.