Cell Biology

Immunogen protein tyrosine phosphatase, receptor type, Q recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Receptor-type tyrosine-protein phosphatase R precursor recombinant protein epitope signature tag (PrEST) Application Anti-PTPRR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Immunogen protein tyrosine phosphatase, receptor type, R Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

PTRH1 (peptidyl-tRNA hydrolase) is responsible for release of tRNA from peptidyl-tRNA by breaking the ester bong between the peptide and the tRNA. Immunogen Probable peptidyl-tRNA hydrolase recombinant protein epitope signature tag (PrEST)

Peptidyl-tRNA hydrolase 2 (PTRH2) is primarily a mitochondrial protein and is mainly expressed in the developing brain. It contains an amino-terminal signaling sequence which is involved in its mitochondrial localization.

Immunogen 6-Pyruvoyltetrahydrobiopterin synthase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen pituitary tumor-transforming 1 interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Pituitary homeobox 1 (Ptx1 also known as Paired-like homeodomain transcription factor 1, Pituitary homeobox 1, or Hindlimb-expressed homeobox protein backfoot) is a nuclear transcription factor encoded by the Pitx1 (also known as Bft, Potx, Ptx1)

Pitx3, the third member of the Pitx family, is expressed in the eyes and in only one population of neurons, the dopaminergic neurons of the midbrain. In human, mutations of the Pitx3 gene have been associated with a familial form of cataracts,

Immunogen Recombinant protein corresponding to pentraxin 4 Sequence GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Synthetic peptide directed towards the C terminal region of human PUF60 Biochem/physiol Actions PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs.

PUMA is one of the pro-apoptotic Bcl-2 family members including Bax and Noxa, which are also transcriptional targets of p53. The PUMA gene encodes two BH3 domain-containing proteins termed PUMA-a and PUMA-b.