Cell Biology

Immunogen RAS p21 protein activator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

RAS protein activator like 2 (RASAL2) is a GTPase activating protein (GAPs) and possesses a GAP-related domain (GRD). Immunogen Ras GTPase-activating protein nGAP recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies

Immunogen RAS, dexamethasone-induced 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

GTP-binding protein Rhes is a protein encoded by the RASD2 gene in humans. It is referred as Rhes, TEM2, MGC:4834 and is mapped to human chromosome 22q13.

Immunogen RasGEF domain family, member 1C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Ras protein-specific guanine nucleotide-releasing factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

The gene Ras-specific guanine nucleotide-releasing factor-2 (RASGRF2) is mapped to human chromosome 5q13. It belongs to a family of calcium/calmodulin-regulated guanine-nucleotide exchange factors.

Immunogen Recombinant protein corresponding to RAS guanyl releasing protein 1 Sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD Application All Prestige Antibodies Powered by Atlas

Immunogen RAS guanyl releasing protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen RAS guanyl-releasing protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen RAS guanyl releasing protein 3 (calcium and DAG-regulated) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to Ras interacting protein 1 Sequence CNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by