-
Add to Cart The item has been addedHPA040735-100ULThe Ras association domain family 1 A (RASSF1A) is a tumor suppressor gene that spans around 1859bp and has 6 exons (1α, 2αβ, 3, 4, 5, 6). The C terminal region of RASSF1A has a Salvador-RASSF1A-Hippo (SARAH) domain and ATM (ataxia -
Add to Cart The item has been addedHPA040406-100ULImmunogen Recombinant protein corresponding to Ras association domain family member 10 Sequence RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA051200-100ULImmunogen Ras association (RalGDS/AF-6) domain family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA038469-100ULImmunogen Ras association (RalGDS/AF-6) domain family member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA038834-100ULSigma-Aldrich
Anti-RASSF4 antibody produced in rabbit (C15-1455-464)
Price: $928.29List Price: $1,031.43Immunogen Ras association (RalGDS/AF-6) domain family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA077069-100ULSigma-Aldrich
ANTI-RASSF4 ANTIBODY PRODUCED IN RABBIT (C15-1466-983)
Price: $977.14List Price: $1,085.71Immunogen Ras association domain family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA070480-100ULImmunogen Ras association (RalGDS/AF-6) domain family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA037712-100ULImmunogen Ras association (RalGDS/AF-6) domain family member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078015-100ULImmunogen Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedAB755PCollagen Type I extracted and purified from rat skin. Antibody shows less than 0. -
Add to Cart The item has been addedA8438-.25MLSigma-Aldrich
Anti-Rat IgG (whole molecule)-Alkaline Phosphatase antibody produced in goat (C15-1315-466)
Price: $326.94List Price: $363.27IgG, a monomer, is the predominant antibody circulating in blood which assist in phagocytic destruction of foreign microorganism. Anti-rat IgG (whole molecule)-alkaline phosphatase antibody (diluted 1: 30 000) can be used in rat MPO -
Add to Cart The item has been addedA8438-.5MLSigma-Aldrich
Anti-Rat IgG (whole molecule)-Alkaline Phosphatase antibody produced in goat (C15-1315-467)
Price: $541.84List Price: $602.04IgG, a monomer, is the predominant antibody circulating in blood which assist in phagocytic destruction of foreign microorganism. Anti-rat IgG (whole molecule)-alkaline phosphatase antibody (diluted 1: 30 000) can be used in rat MPO
