Cell Biology

Immunogen regulator of G-protein signaling 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Regulator of G-protein signaling 12 is a protein encoded by the RGS12 gene in humans belonging to the RGS protein family. It is a nuclear protein that exhibits a unique pattern of subnuclear organization into nuclear foci or dots when expressed

Immunogen regulator of G protein signaling 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen regulator of G-protein signaling 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Immunogen Sequence: GI # 4506513 , sequence 130-202 Recombinant regulator of G-protein signalling 16 Application Anti-RGS16 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell

Immunogen regulator of G-protein signaling 16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen regulator of G-protein signaling 16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

RGS17 (Regulator of G-protein signaling 17) is majorly involved in the regulation of G protein-coupled receptor signaling pathway. Specifically, it suppresses receptor signaling via G(i/o), G(z), and G(q) over G(s), which in turn enhances

Immunogen regulator of G-protein signaling 17 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Synthetic peptide directed towards the N terminal region of human RGS18 Biochem/physiol Actions RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 18. Sequence FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen regulator of G-protein signaling 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,