Cell Biology

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen regulator of G-protein signaling 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Synthetic peptide directed towards the middle region of human RGS20 Biochem/physiol Actions Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are

Immunogen regulator of G-protein signaling 21 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the C terminal region of human RGS3 Application Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 &#956g/ml.

Immunogen regulator of G-protein signaling 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen regulator of G protein signaling 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Regulator of G-protein signaling 4 (RGS4) is a GTPase activating protein belonging to the RGS family. This is a group of proteins known to act as GTPase activating proteins (GAPs), in order to regulate G protein signaling.

Immunogen Synthetic peptide directed towards the C terminal region of human RGS6 Biochem/physiol Actions Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the

Immunogen Regulator of G-protein signaling 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene RHBDD1 (rhomboid domain containing 1) is a serine protease belonging to the Rhomboid family of proteins. The protein contains a rhomboid domain and is highly expressed in the testis.

Immunogen rhomboid domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are