-
Add to Cart The item has been addedHPA066509-100ULSigma-Aldrich
Anti-RNASET2 antibody produced in rabbit (C15-1465-097)
Price: $928.29List Price: $1,031.43Immunogen ribonuclease T2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA077800-100ULImmunogen Rho family GTPase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA077757-100ULImmunogen Recombinant protein corresponding to Rho family GTPase 2 Sequence GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA060504-100ULImmunogen Rho family GTPase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA052643-100ULImmunogen ring finger protein 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA057922-100ULImmunogen ring finger protein 103 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038576-100ULSigma-Aldrich
Anti-RNF111 antibody produced in rabbit (C15-1455-327)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 111 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA038577-100ULSigma-Aldrich
Anti-RNF111 antibody produced in rabbit (C15-1455-328)
Price: $928.29List Price: $1,031.43Immunogen ring finger protein 111 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA015970-100ULImmunogen RING finger protein 112 (Zinc finger protein 179) (Brain finger protein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA000160-100ULSigma-Aldrich
Anti-RNF113A antibody produced in rabbit (C15-1444-876)
Price: $879.43List Price: $977.14Immunogen RING finger protein 113A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA076658-100ULSigma-Aldrich
Anti-RNF113A antibody produced in rabbit (C15-1466-924)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ring finger protein 113A Sequence PAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA021184-100ULThe gene RNF114 (ring finger protein 114) is mapped to human chromosome 20q13.13.
