-
Add to Cart The item has been addedHPA007459-100ULSigma-Aldrich
Anti-ROCK2 antibody produced in rabbit (C15-1446-899)
Price: $879.43List Price: $977.14ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates -
Add to Cart The item has been addedHPA044109-100ULSigma-Aldrich
Anti-ROCK2 antibody produced in rabbit (C15-1458-025)
Price: $928.29List Price: $1,031.43Immunogen Rho-associated, coiled-coil containing protein kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA028910-100ULSigma-Aldrich
Anti-ROM1 antibody produced in rabbit (C15-1452-052)
Price: $879.43List Price: $977.14Immunogen retinal outer segment membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA073279-100ULSigma-Aldrich
ANTI-ROM1 ANTIBODY PRODUCED IN RABBIT (C15-1466-347)
Price: $977.14List Price: $1,085.71Immunogen retinal outer segment membrane protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV45622-100ULThe previously assigned protein identifier Q5SZR9 has been merged into P51449. Full details can be found on the UniProt database. -
Add to Cart The item has been addedHPA042257-100ULRetinitis pigmentosa-1 (RP1) is a photoreceptor microtubule-associated protein. RP1 belongs to end binding protein 1(EB1) protein family, which interacts with adenomatous polyposis coli (APC). -
Add to Cart The item has been addedHPA068942-100ULImmunogen Recombinant protein corresponding to Sequence YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA024686-100ULSigma-Aldrich
Anti-RP1L1 antibody produced in rabbit (C15-1450-855)
Price: $879.43List Price: $977.14Immunogen retinitis pigmentosa 1-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA024744-100ULSigma-Aldrich
Anti-RP1L1 antibody produced in rabbit (C15-1450-874)
Price: $879.43List Price: $977.14Immunogen retinitis pigmentosa 1-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA000234-100ULSigma-Aldrich
Anti-RP2 antibody produced in rabbit (C15-1444-888)
Price: $879.43List Price: $977.14Immunogen Protein XRP2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA000909-100ULSigma-Aldrich
Anti-RP2 antibody produced in rabbit (C15-1445-097)
Price: $879.43List Price: $977.14Immunogen retinitis pigmentosa 2 (X-linked recessive) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA006914-100ULSigma-Aldrich
Anti-RPA1 antibody produced in rabbit (C15-1446-757)
Price: $879.43List Price: $977.14Immunogen Replication protein A 70 kDa DNA-binding subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
