-
Add to Cart The item has been addedHPA054510-100ULSigma-Aldrich
Anti-RPS15 antibody produced in rabbit (C15-1461-703)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein S15 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA057793-100ULSigma-Aldrich
Anti-RPS15 antibody produced in rabbit (C15-1462-756)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein S15 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA047103-100ULImmunogen ribosomal protein S15a recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA055060-100ULImmunogen ribosomal protein S17 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA050159-100ULSigma-Aldrich
Anti-RPS18 antibody produced in rabbit (C15-1460-205)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein S18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA055007-100ULSigma-Aldrich
Anti-RPS18 antibody produced in rabbit (C15-1461-860)
Price: $928.29List Price: $1,031.43Immunogen ribosomal protein S18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA063217-100ULImmunogen Recombinant protein corresponding to ribosomal protein S19 Sequence LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA003570-100ULImmunogen 40S ribosomal protein S20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA003371-100ULRPS21 (ribosomal protein S21) is a housekeeping gene and is located in GC-rich genome islets. Immunogen 40S ribosomal protein S21 recombinant protein epitope signature tag (PrEST) Application Anti-RPS21 antibody produced in rabbit, a Prestige -
Add to Cart The item has been addedHPA054853-100ULImmunogen ribosomal protein S23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA031801-100ULSigma-Aldrich
Anti-RPS25 antibody produced in rabbit (C15-1453-283)
Price: $889.20List Price: $988.00Immunogen ribosomal protein S25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA078683-100ULSigma-Aldrich
ANTI-RPS25 ANTIBODY PRODUCED IN RABBIT (C15-1467-186)
Price: $977.14List Price: $1,085.71Immunogen ribosomal protein S25 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
