-
HPA043483-100ULImmunogen ribosomal L1 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA062724-100UL
Sigma-Aldrich
Anti-RSL24D1 antibody produced in rabbit (C15-1464-171)
Price: $928.29List Price: $1,031.43Immunogen ribosomal L24 domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA063392-100UL
Sigma-Aldrich
Anti-RSL24D1 antibody produced in rabbit (C15-1464-351)
Price: $928.29List Price: $1,031.43Immunogen ribosomal L24 domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA052511-100ULImmunogen retbindin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA027982-100UL
Sigma-Aldrich
Anti-RTCA antibody produced in rabbit (C15-1451-674)
Price: $879.43List Price: $977.14Immunogen RNA terminal phosphate cyclase domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027990-100UL
Sigma-Aldrich
Anti-RTCA antibody produced in rabbit (C15-1451-676)
Price: $879.43List Price: $977.14Immunogen RNA 3′-terminal phosphate cyclase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028151-100UL
Sigma-Aldrich
Anti-RTCA antibody produced in rabbit (C15-1451-725)
Price: $879.43List Price: $977.14Immunogen RNA terminal phosphate cyclase domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA000535-100UL
Sigma-Aldrich
Anti-RTCB antibody produced in rabbit (C15-1444-971)
Price: $879.43List Price: $977.14Immunogen RNA 2′,3′-cyclic phosphate and 5′-OH ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA001103-100UL
Sigma-Aldrich
Anti-RTCB antibody produced in rabbit (C15-1445-163)
Price: $879.43List Price: $977.14Immunogen UPF0027 protein C22orf28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA020622-100UL
Sigma-Aldrich
Anti-RTEL1 antibody produced in rabbit (C15-1449-654)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to regulator of telomere elongation helicase 1 Sequence VFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARKRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWV Application All -
HPA067329-100UL
Sigma-Aldrich
Anti-RTEL1 antibody produced in rabbit (C15-1465-276)
Price: $928.29List Price: $1,031.43Immunogen regulator of telomere elongation helicase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA078328-100UL
Sigma-Aldrich
Anti-RTEL1 antibody produced in rabbit (C15-1467-159)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to regulator of telomere elongation helicase 1 Sequence HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT Application All Prestige Antibodies Powered by Atlas