-
HPA064887-100UL
Sigma-Aldrich
Anti-RTP4 antibody produced in rabbit (C15-1464-766)
Price: $928.29List Price: $1,031.43Immunogen receptor (chemosensory) transporter protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA071189-100UL
Sigma-Aldrich
Anti-RTP4 antibody produced in rabbit (C15-1465-994)
Price: $928.29List Price: $1,031.43Immunogen receptor (chemosensory) transporter protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA050902-100ULImmunogen receptor (chemosensory) transporter protein 5 (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA038804-100UL
Sigma-Aldrich
Anti-RUFY1 antibody produced in rabbit (C15-1455-451)
Price: $928.29List Price: $1,031.43Immunogen RUN and FYVE domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA057614-100UL
Sigma-Aldrich
Anti-RUFY1 antibody produced in rabbit (C15-1462-711)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RUN and FYVE domain containing 1. Sequence NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA022952-100UL
Sigma-Aldrich
Anti-RUFY3 antibody produced in rabbit (C15-1450-185)
Price: $879.43List Price: $977.14Immunogen RUN and FYVE domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA022970-100UL
Sigma-Aldrich
Anti-RUFY3 antibody produced in rabbit (C15-1450-194)
Price: $879.43List Price: $977.14The gene RUFY3 (RUN and FYVE domain containing 3) is mapped to human chromosome 4q13. It is strongly expressed in brain tissue. -
HPA037980-100ULImmunogen RUN and FYVE domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA023548-100UL
Sigma-Aldrich
Anti-RUNDC3A antibody produced in rabbit (C15-1450-431)
Price: $879.43List Price: $977.14The gene RUNDC3A (RUN domain containing 3A) encodes a protein that contains the RUN domain and is mapped to human chromosome 17q21.31. -
HPA070733-100UL
Sigma-Aldrich
Anti-RUNDC3A antibody produced in rabbit (C15-1465-897)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RUN domain containing 3A Sequence TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA056968-100UL
Sigma-Aldrich
Anti-RUNDC3B antibody produced in rabbit (C15-1462-512)
Price: $928.29List Price: $1,031.43Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057155-100UL
Sigma-Aldrich
Anti-RUNDC3B antibody produced in rabbit (C15-1462-571)
Price: $928.29List Price: $1,031.43Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the