Cell Biology

Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene RUSC2 (RUN and SH3 domain-containing protein 2) is mapped to human chromosome 9p13.1.

The gene RWDD2B (RWD domain-containing protein 2B) is mapped to human chromosome 21q22.11.

Relaxin/insulin like family peptide receptor 1 (RXFP1) functions as a receptor for the hormone relaxin. It is expressed on the cell surface.

Immunogen Relaxin-3 receptor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Synthetic peptide directed towards the C terminal region of human RXRG Biochem/physiol Actions RXRG belongs to the retinoid receptor family of nuclear receptors that mediate the cellular effects of retinoic acid. RXRG increases DNA

Immunogen receptor-like tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to receptor-like tyrosine kinase Sequence LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

RYR2 (ryanodine receptor 2) is an intracellular Ca 2+ release channel present on the sarcoplasmic reticulum (SR). RYR2 gene is located at the human chromosome location 1q43.