-
Add to Cart The item has been addedAb090171-50?lRabbit anti Human ATP6V1B1 Antibody, Polyclonal, could be used for WB, IHC, ICC, IF and so on.Application:WB: 1/1000:IHC: 1/100-1/500:ICC/IF: 1/10-1/50:Protein Function:Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase -
Add to Cart The item has been addedHPA031847-100ULAnti-ATP6V1B1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA008147-100ULAnti-ATP6V1B2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen V-type proton ATPase subunit B, brain isoform recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA023943-100ULAnti-ATP6V1C1 antibody produced in rabbit (C15-1450-573)
Price: $879.43List Price: $977.14ATP6V1C1 (ATPase H + transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase). Immunogen V-type proton ATPase subunit C 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA057297-100ULAnti-ATP6V1C1 antibody produced in rabbit (C15-1462-618)
Price: $928.29List Price: $1,031.43Immunogen ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA067305-100ULAnti-ATP6V1C2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ATPase H+ transporting V1 subunit C2 Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA031515-100ULAnti-ATP6V1D antibody produced in rabbit (C15-1453-152)
Price: $889.20List Price: $988.00Immunogen ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA057316-100ULAnti-ATP6V1D antibody produced in rabbit (C15-1462-626)
Price: $928.29List Price: $1,031.43Immunogen ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA029196-100ULAnti-ATP6V1E1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA052784-100ULAnti-ATP6V1E2 antibody produced in rabbit (C15-1461-136)
Price: $928.29List Price: $1,031.43Immunogen ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA075092-100ULANTI-ATP6V1E2 ANTIBODY PRODUCED IN RABBIT (C15-1466-672)
Price: $977.14List Price: $1,085.71Immunogen ATPase H+ transporting V1 subunit E2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048700-100ULAnti-ATP6V1F antibody produced in rabbit (C15-1459-688)
Price: $928.29List Price: $1,031.43Immunogen ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
