Cell Biology

Monoclonal Anti-Avidin (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Avidin is a glycoprotein (68 kDa) composed of four identical polypeptide chains

Immunogen Recombinant protein corresponding to arginine vasopressin receptor 1B Sequence LSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen axonemal dynein light chain domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Axin1 contains two conserved domains, an N-terminal regulator of G-protein signaling (RGS) domain, and a C-terminal DIX domain. The C-terminal region of axin1 is important for homodimerization, whereas the central region binds &#946-catenin and

B2M (&#946-2-microglobulin) is the invariant light chain of the HLA antigen protein. It is low molecular weight protein.

Immunogen Synthetic peptide directed towards the N terminal region of human B3GALT6 Application Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x

B4GALNT1 (&#946-1,4- N -acetyl-galactosaminyl transferase 1) gene localizes to human chromosome 12q, and codes for the enzyme GM synthase. Immunogen &#946-1,4 N-Acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)