Cell Biology

BAG (BCL2 associated athanogene) family molecular chaperone regulator-3 (BAG3) is a member of BAG family of co-chaperones that interacts with Hsp70 (Heat shock protein 70). Immunogen BAG family molecular chaperone regulator 3 recombinant protein

Immunogen BAG family molecular chaperone regulator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen BCL2-associated athanogene 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen BCL2-associated athanogene 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen BAH domain and coiled-coil containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to BAH domain and coiled-coil containing 1 Sequence SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA Application All Prestige Antibodies Powered by Atlas Antibodies

Bak or Bcl2 homologous antagonist is a member of the Bcl2 family of proteins. The Bcl-2 related proteins interact with one another through the formation of homo and heterodimers.

Bak (Bcl-2 homologous antagonist/killer, Bak1) belongs to the B-cell lymphoma 2 (Bcl-2) family of proteins. The bak gene is mapped to chromosome 6 and encodes a 233 amino acid protein with a predicted MW of 23.

Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane glycoprotein which is a pseudo receptor belonging to the family of TGF-&#946 (transforming growth factor beta receptor) type I receptors. BAMBI is

BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) is a pseudoreceptor of TGF-&#946, and is highly conserved in vertebrates. This protein is a transmembrane glycoprotein and shows homology with TGF-&#946 type I receptors.

Immunogen barrier to autointegration factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen B-cell scaffold protein with ankyrin repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a