Other Peptides

Amino Acid Sequence Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2 [Disulfide Bridge: 1-6] Application [Lys 8 ]-Vasopressin was used as a test compound in quantitative analysis of peptides and proteins by using on-line capillary isoelectric

Amino Acid Sequence Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2 [Disulfide Bridge: 1-6] Application [Lys 8 ]-Vasopressin was used as a test compound in quantitative analysis of peptides and proteins by using on-line capillary isoelectric

The purity of every peptide is &gt 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFGHDSGFEVRHQK

The purity of every peptide is &gt 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFGHDSGFEVRHQK

5 x RIPA Buffer IV with Triton-X-100 (pH 7.4) 5x concentrate: RIPA buffer is one of the most reliable buffers used to lyse cultured mammalian cells from both plated cells and cells pelleted from suspension cultures.

Albumin constitutes 25% of the proteins produced by the liver and is a prominent protein found in the blood. It is a protein of a single polypeptide chain with a thiol group.

Albumin constitutes 25% of the proteins produced by the liver and is a prominent protein found in the blood. It is a protein of a single polypeptide chain with a thiol group.

Immunogen Synthetic peptide directed towards the middle region of human A4GALT Biochem/physiol Actions The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been

General description Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes

Immunogen Synthetic peptide directed towards the middle region of human ACTR1A Sequence Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP Physical form Purified antibody supplied in 1x

Immunogen The immunogen for anti-ADAMTS6 antibody: synthetic peptide derected towards the C terminal of human ADAMTS6 Sequence Synthetic peptide located within the following region: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE Physical

Immunogen The immunogen for anti-ANGPT1 antibody: synthetic peptide derected towards the C terminal of human ANGPT1 Sequence Synthetic peptide located within the following region: EFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT Physical