-
Add to Cart The item has been addedHPA054359-100ULSigma-Aldrich
Anti-NDUFA1 antibody produced in rabbit (C15-1461-653)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA059529-100ULSigma-Aldrich
Anti-NDUFA10 antibody produced in rabbit (C15-1463-296)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA067045-100ULSigma-Aldrich
Anti-NDUFA10 antibody produced in rabbit (C15-1465-206)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NADH:ubiquinone oxidoreductase subunit A10 Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT Application All Prestige -
Add to Cart The item has been addedHPA072209-100ULImmunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA039903-100ULImmunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA041213-100ULImmunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA035933-100ULImmunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA078265-100ULImmunogen NDUFA4, mitochondrial complex associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059251-100ULSigma-Aldrich
Anti-NDUFA7 antibody produced in rabbit (C15-1463-200)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA071866-100ULSigma-Aldrich
Anti-NDUFA7 antibody produced in rabbit (C15-1466-123)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA041510-100ULSigma-Aldrich
Anti-NDUFA8 antibody produced in rabbit (C15-1456-741)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA041600-100ULSigma-Aldrich
Anti-NDUFA8 antibody produced in rabbit (C15-1456-786)
Price: $928.29List Price: $1,031.43Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
