Cell Culture Reagents

Immunogen NADH:ubiquinone oxidoreductase subunit C1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application Anti-NDUFV2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human

Immunogen NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen N-terminal EF-hand calcium binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 3 Sequence SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to N-terminal EF-hand calcium binding protein 3 Sequence DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

The gene NEDD4L (neural precursor cell expressed, developmentally down-regulated 4-like) is mapped to human chromosome 18q21. The protein localizes in the cytoplasm.

Immunogen neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen neurofilament, light polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Neuronal growth regulator 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,