-
HPA037948-100UL
Sigma-Aldrich
Anti-OLAH antibody produced in rabbit (C15-1454-991)
Price: $928.29List Price: $1,031.43Immunogen oleoyl-ACP hydrolase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA027991-100ULImmunogen Recombinant protein corresponding to olfactomedin like 3 Sequence LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA067673-100ULImmunogen oxoglutarate (alpha-ketoglutarate) receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA030247-100ULImmunogen poly(rC) binding protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA017976-100ULProtocadherin 18 (PCDH18) is part of the cadherin superfamily. It is located at the synapses in the central nervous system and contains six ectodomain repeats with cadherin-like features.
-
HPA062669-100ULImmunogen Recombinant protein corresponding to protocadherin 20 Sequence GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
-
HPA035653-100ULImmunogen protocadherin alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA059326-100UL
Sigma-Aldrich
Anti-PCDHA6 antibody produced in rabbit (C15-1463-219)
Price: $928.29List Price: $1,031.43Immunogen protocadherin alpha 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA078110-100UL
Sigma-Aldrich
Anti-PCDHA6 antibody produced in rabbit (C15-1467-135)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to protocadherin alpha 6 Sequence PSLSPCPIMMGKAENQDLNEDHDAKV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA013191-100UL
Sigma-Aldrich
Anti-PCDHB5 antibody produced in rabbit (C15-1447-935)
Price: $879.43List Price: $977.14Immunogen Protocadherin beta-5 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA067473-100UL
Sigma-Aldrich
ANTI-PCDHB5 ANTIBODY PRODUCED IN RABBIT (C15-1465-308)
Price: $977.14List Price: $1,085.71Immunogen protocadherin beta 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA029566-100UL
Sigma-Aldrich
Anti-PCDHB6 antibody produced in rabbit (C15-1452-320)
Price: $879.43List Price: $977.14Immunogen protocadherin beta 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by